PDB entry 1gh9

View 1gh9 on RCSB PDB site
Description: solution structure of a 8.3 kda protein (gene mth1184) from methanobacterium thermoautotrophicum
Class: structural genomics, unknown function
Keywords: BETA+ALPHA COMPLEX STRUCTURE, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2000-11-30, released 2000-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 8.3 kda protein (gene mth1184)
  Species: Methanothermobacter thermautotrophicus [TaxId:145262]
  Gene: MTH1184
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27252 (0-70)
  Domains in SCOPe 2.08: d1gh9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gh9A (A:)
  myiifrcdcgralysregaktrkcvcgrtvnvkdrrifgraddfeeaselvrklqeekyg
  schftnpskre