PDB entry 1gh7

View 1gh7 on RCSB PDB site
Description: crystal structure of the complete extracellular domain of the beta-common receptor of il-3, il-5, and gm-csf
Class: cytokine receptor
Keywords: Dimer of interlocking chains of fibronectin-III domains Four fibronectin-III domains per chain
Deposited on 2000-11-27, released 2001-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2001-11-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.267
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytokine receptor common beta chain
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32927 (0-End)
      • insertion (266)
      • engineered (327)
    Domains in SCOP 1.73: d1gh7a1, d1gh7a2, d1gh7a3, d1gh7a4
  • Chain 'B':
    Compound: cytokine receptor common beta chain
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32927 (0-End)
      • insertion (266)
      • engineered (327)
    Domains in SCOP 1.73: d1gh7b1, d1gh7b2, d1gh7b3, d1gh7b4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gh7A (A:)
    eetiplqtlrcyndytshitcrwadtqdaqrlvnvtlirrvnedllepvscdlsddmpws
    acphprcvprrcvipcqsfvvtdvdyfsfqpdrplgtrltvtltqhvqppeprdlqistd
    qdhflltwsvalgspqshwlspgdlefevvykrlqdswedaaillsntsqatlgpehlmp
    sstyvarvrtrlapgsrlsgrpskwspevcwdsqpgdeaqpqnlecffdgaavlscswev
    rkevassvsfglfykpspdagsavllreeecspvlreglgslhtrhhcqipvpdpathgq
    yivsvqprraekhikssvniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrk
    dtatwkdsktetlqnahsmalpalepstrywarvrvrtsrtgyngiwsewsearswdte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gh7A (A:)
    eetiplqtlrcyndytshitcrwadtqdaqrlvnvtlirrvnedllepvscdlsddmpws
    acphprcvprrcvipcqsfvvtdvdyfsfqpdrplgtrltvtltqhvqppeprdlqistd
    qdhflltwsvalgspqshwlspgdlefevvykrlqdswedaaillsntsqatlgpehlmp
    sstyvarvrtrlapgsrlsgrpskwspevcwdsqpgdeaqpqnlecffdgaavlscswev
    rkevassvsfglfykpspreeecspvlreglgslhtrhhcqipvpdpathgqyivsvqpr
    raekhikssvniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkds
    ktetlqnahsmalpalepstrywarvrvrtsrtgyngiwsewsearsw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gh7B (B:)
    eetiplqtlrcyndytshitcrwadtqdaqrlvnvtlirrvnedllepvscdlsddmpws
    acphprcvprrcvipcqsfvvtdvdyfsfqpdrplgtrltvtltqhvqppeprdlqistd
    qdhflltwsvalgspqshwlspgdlefevvykrlqdswedaaillsntsqatlgpehlmp
    sstyvarvrtrlapgsrlsgrpskwspevcwdsqpgdeaqpqnlecffdgaavlscswev
    rkevassvsfglfykpspdagsavllreeecspvlreglgslhtrhhcqipvpdpathgq
    yivsvqprraekhikssvniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrk
    dtatwkdsktetlqnahsmalpalepstrywarvrvrtsrtgyngiwsewsearswdte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gh7B (B:)
    eetiplqtlrcyndytshitcrwadtqdaqrlvnvtlirrvnedllepvscdlsddmpws
    acphprcvprrcvipcqsfvvtdvdyfsfqpdrplgtrltvtltqhvqppeprdlqistd
    qdhflltwsvalgspqshwlspgdlefevvykrlqdswedaaillsntsqatlgpehlmp
    sstyvarvrtrlapgsrlsgrpskwspevcwdsqpgdeaqpqnlecffdgaavlscswev
    rkevassvsfglfykpspreeecspvlreglgslhtrhhcqipvpdpathgqyivsvqpr
    raekhikssvniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkds
    ktetlqnahsmalpalepstrywarvrvrtsrtgyngiwsewsearsw