PDB entry 1gh6

View 1gh6 on RCSB PDB site
Description: retinoblastoma pocket complexed with sv40 large t antigen
Deposited on 2000-11-15, released 2001-11-15
The last revision prior to the SCOP 1.71 freeze date was dated 2001-11-15, with a file datestamp of 2001-11-15.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.248
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gh6A (A:)
    shmreeslqlmdllglersawgniplmrkaylkkckefhpdkggdeekmkkmntlykkme
    dgvkyahqpdfggfwdateiptygtdeweqwwnafneenlfcseempssddeat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gh6B (B:)
    mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagc
    vaigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
    srstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrim
    eslawlsdsplfdlikqsklvprgstslslfykkvyrlaylrlntlcerllsehpelehi
    iwtlfqhtlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetf
    krvlikeeeydsiivfynsvfmqrlktnilqya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gh6B (B:)
    mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagc
    vaigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
    srsttdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawls
    dsplfdlikqsklvprgstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqh
    tlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlike
    eeydsiivfynsvfmqrlktnilqya