PDB entry 1gh5

View 1gh5 on RCSB PDB site
Description: antifungal protein from streptomyces tendae tu901, nmr average structure
Class: antifungal protein
Keywords: all-beta, two antiparallel beta-sheets, parallel beta-sandwich, antifungal protein
Deposited on 2000-11-04, released 2001-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antifungal protein
    Species: Streptomyces tendae [TaxId:1932]
    Gene: AFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RCK8 (1-86)
      • initiating met (0)
    Domains in SCOPe 2.08: d1gh5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gh5A (A:)
    minrtdcnensyleihnnegrdtlcfanagtmpvaiygvnwvesgnnvvtlqfqrnlsdp
    rletitlqkwgswnpghiheilsiriy