PDB entry 1gh2

View 1gh2 on RCSB PDB site
Description: Crystal structure of the catalytic domain of a new human thioredoxin-like protein
Class: Electron transport
Keywords: Redox-active center, Electron transport
Deposited on 2000-11-01, released 2001-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.221
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin-like protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43396 (0-106)
    • conflict (78)
  Domains in SCOPe 2.08: d1gh2a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gh2A (A:)
  vgvkpvgsdpdfqpelsgagsrlavvkftmrgcgpclriapafssmsnkypqavflevdv
  hqcqgtaatnnisatptfqffrnkvridqyqgadavgleekikqhle