PDB entry 1ggw

View 1ggw on RCSB PDB site
Description: cdc4p from schizosaccharomyces pombe
Deposited on 2000-09-25, released 2001-03-21
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ggwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ggwA (A:)
stddspykqafslfdrhgtgripktsigdllracgqnptlaeiteiestlpaevdmeqfl
qvlnrpngfdmpgdpeefvkgfqvfdkdatgmigvgelryvltslgeklsneemdellkg
vpvkdgmvnyhdfvqmilan