PDB entry 1ggw

View 1ggw on RCSB PDB site
Description: cdc4p from schizosaccharomyces pombe
Class: cytokine
Keywords: light chain, cytokinesis, cell cycle, ef-hand
Deposited on 2000-09-25, released 2001-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cdc4p)
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ggwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggwA (A:)
    stddspykqafslfdrhgtgripktsigdllracgqnptlaeiteiestlpaevdmeqfl
    qvlnrpngfdmpgdpeefvkgfqvfdkdatgmigvgelryvltslgeklsneemdellkg
    vpvkdgmvnyhdfvqmilan