PDB entry 1ggu

View 1ggu on RCSB PDB site
Description:
Deposited on 1998-07-22, released 1999-09-16
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.227
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gguA (A:)
    fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
    kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
    gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
    ceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqm
    dlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssen
    pvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkd
    svwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfd
    apfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegq
    eeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnry
    titaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhff
    vtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhl
    dgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gguA (A:)
    fggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyennklivrrg
    qsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmred
    rsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyldnek
    ereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnpikvs
    rvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqcwvfag
    vfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcwneaw
    mtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaevnsdl
    iyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaletalm
    ygakkplntsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpka
    efkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstv
    ltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpn
    stvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gguB (B:)
    fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
    kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
    gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
    ceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqm
    dlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssen
    pvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkd
    svwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfd
    apfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegq
    eeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnry
    titaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhff
    vtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhl
    dgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gguB (B:)
    fggrravppnnsnaaeddlptvelqgvvqeflnvtsvhlfkerwdtnkvdhhtdkyennk
    livrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgak
    ivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddav
    yldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrg
    npikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygq
    cwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyh
    cwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfa
    evnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerla
    letalmygakkplntsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfy
    tgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvla
    kqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmf
    reirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr