PDB entry 1ggt

View 1ggt on RCSB PDB site
Description:
Deposited on 1994-01-25, released 1995-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.216
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ggtA (A:)
    fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
    kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
    gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
    ceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqm
    dlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssen
    pvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkd
    svwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfd
    apfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegq
    eeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnry
    titaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhff
    vtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhl
    dgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    rp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggtA (A:)
    fggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyennklivrrg
    qsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmred
    rsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyldnek
    ereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnpikvs
    rvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqcwvfag
    vfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcwneaw
    mtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaevnsdl
    iyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaletalm
    ygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitf
    ytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvl
    akqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkm
    freirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqrrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ggtB (B:)
    fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
    kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
    gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
    ceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqm
    dlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssen
    pvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkd
    svwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfd
    apfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegq
    eeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnry
    titaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhff
    vtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhl
    dgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggtB (B:)
    fggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyennklivrrg
    qsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmred
    rsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyldnek
    ereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnpikvs
    rvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqcwvfag
    vfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcwneaw
    mtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaevnsdl
    iyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaletalm
    ygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitf
    ytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvl
    akqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkm
    freirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr