PDB entry 1ggs

View 1ggs on RCSB PDB site
Description: nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin I.
Class: contractile protein
Keywords: troponin c-troponin I interaction, cardiac, muscle protein, calcium binding protein
Deposited on 1999-04-28, released 2000-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-08-23, with a file datestamp of 2007-04-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (troponin c)
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ggsa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggsA (A:)
    mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdg
    dknndgridydeflefmkgve