PDB entry 1ggq

View 1ggq on RCSB PDB site
Description: outer surface protein c (ospc) of borrelia burgdorferi strain b31
Deposited on 2000-09-14, released 2001-03-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-14, with a file datestamp of 2001-03-14.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.231
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ggqa_
  • Chain 'B':
    Domains in SCOP 1.59: d1ggqb_
  • Chain 'C':
    Domains in SCOP 1.59: d1ggqc_
  • Chain 'D':
    Domains in SCOP 1.59: d1ggqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggqA (A:)
    gpnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngsll
    agayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadakea
    ilktngtktkgaeelgklfesvevlskaakemlansvkelts
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggqB (B:)
    pnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngslla
    gayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadakeai
    lktngtktkgaeelgklfesvevlskaakemlansvkeltsp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggqC (C:)
    gpnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngsll
    agayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadakea
    ilktngtktkgaeelgklfesvevlskaakemlansvkelts
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggqD (D:)
    pnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngslla
    gayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadakeai
    lktngtktkgaeelgklfesvevlskaakemlansvkeltsp