PDB entry 1ggq

View 1ggq on RCSB PDB site
Description: outer surface protein c (ospc) of borrelia burgdorferi strain b31
Class: membrane protein
Keywords: Lyme disease antigen, helical bundle, homodimer, MEMBRANE PROTEIN
Deposited on 2000-09-14, released 2001-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.231
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:224326]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ggqa_
  • Chain 'B':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:224326]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ggqb_
  • Chain 'C':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:224326]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ggqc_
  • Chain 'D':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:224326]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ggqd_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ggqA (A:)
    mkgpnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngs
    llagayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadak
    eailktngtktkgaeelgklfesvevlskaakemlansvkeltspvvaespkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggqA (A:)
    gpnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngsll
    agayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadakea
    ilktngtktkgaeelgklfesvevlskaakemlansvkelts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ggqB (B:)
    mkgpnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngs
    llagayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadak
    eailktngtktkgaeelgklfesvevlskaakemlansvkeltspvvaespkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggqB (B:)
    pnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngslla
    gayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadakeai
    lktngtktkgaeelgklfesvevlskaakemlansvkeltsp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ggqC (C:)
    mkgpnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngs
    llagayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadak
    eailktngtktkgaeelgklfesvevlskaakemlansvkeltspvvaespkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggqC (C:)
    gpnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngsll
    agayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadakea
    ilktngtktkgaeelgklfesvevlskaakemlansvkelts
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ggqD (D:)
    mkgpnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngs
    llagayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadak
    eailktngtktkgaeelgklfesvevlskaakemlansvkeltspvvaespkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggqD (D:)
    pnlteiskkitdsnavllavkeveallssideiaakaigkkihqnngldtennhngslla
    gayaistlikqkldglkneglkekidaakkcsetftnklkekhtdlgkegvtdadakeai
    lktngtktkgaeelgklfesvevlskaakemlansvkeltsp