PDB entry 1ggm

View 1ggm on RCSB PDB site
Description: glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate
Deposited on 1999-01-27, released 1999-01-28
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-14, with a file datestamp of 2000-02-14.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.242
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggmA (A:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdnakarywtppryfnmmfqdlrgprggrglla
    ylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyf
    vrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgsl
    elegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsag
    vdrgvlallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrlkar
    llalglgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvrdrd
    tmeqirlhvdelegflrerlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggmB (B:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdnakarywtppryfnmmfqdlrgprggrglla
    ylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyf
    vrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgsl
    elegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsag
    vdrgvlallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrlkar
    llalglgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvrdrd
    tmeqirlhvdelegflrerlrw