PDB entry 1ggi

View 1ggi on RCSB PDB site
Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-04-02, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.188
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a 50.1 fab (heavy chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ggih1, d1ggih2
  • Chain 'J':
    Compound: igg2a 50.1 fab (heavy chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ggij1, d1ggij2
  • Chain 'L':
    Compound: igg2a 50.1 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA10344 (2-End)
      • conflict (3)
      • conflict (6)
      • conflict (8)
      • conflict (26)
      • conflict (26)
      • conflict (31)
      • conflict (36)
      • conflict (43)
      • conflict (54)
      • conflict (58)
      • conflict (63)
      • conflict (90)
      • conflict (93)
      • conflict (97)
      • conflict (99)
      • conflict (103)
    Domains in SCOPe 2.07: d1ggil1, d1ggil2
  • Chain 'M':
    Compound: igg2a 50.1 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA10344 (2-End)
      • conflict (3)
      • conflict (6)
      • conflict (8)
      • conflict (26)
      • conflict (26)
      • conflict (31)
      • conflict (36)
      • conflict (43)
      • conflict (54)
      • conflict (58)
      • conflict (63)
      • conflict (90)
      • conflict (93)
      • conflict (97)
      • conflict (99)
      • conflict (103)
    Domains in SCOPe 2.07: d1ggim1, d1ggim2
  • Chain 'P':
    Compound: hiv-1 v3 loop peptide antigen
    Database cross-references and differences (RAF-indexed):
    • PDB 1GGI (0-End)
  • Chain 'Q':
    Compound: hiv-1 v3 loop peptide antigen
    Database cross-references and differences (RAF-indexed):
    • PDB 1GGI (0-End)

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ggiH (H:)
    qvqlkesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
    ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvssaktta
    psvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggiH (H:)
    qvqlkesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
    ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvssaktta
    psvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ggiJ (J:)
    qvqlkesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
    ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvssaktta
    psvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggiJ (J:)
    qvqlkesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
    ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvssaktta
    psvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ggiL (L:)
    divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
    gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggiL (L:)
    divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
    gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1ggiM (M:)
    divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
    gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ggiM (M:)
    divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
    gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.