PDB entry 1ggb

View 1ggb on RCSB PDB site
Description: major antigen-induced domain rearrangements in an antibody
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-07-19, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa 50.1 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ggbh1, d1ggbh2, d1ggbh3
  • Chain 'L':
    Compound: igg2a-kappa 50.1 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA10344 (2-214)
      • conflict (3)
      • conflict (6)
      • conflict (8)
      • conflict (26)
      • conflict (26)
      • conflict (31)
      • conflict (36)
      • conflict (43)
      • conflict (54)
      • conflict (58)
      • conflict (63)
      • conflict (90)
      • conflict (93)
      • conflict (97)
      • conflict (99)
      • conflict (103)
    Domains in SCOPe 2.07: d1ggbl1, d1ggbl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggbH (H:)
    qvqlqesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
    ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvssaktta
    psvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggbL (L:)
    divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
    gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr