PDB entry 1gg3

View 1gg3 on RCSB PDB site
Description: crystal structure of the protein 4.1r membrane binding domain
Deposited on 2000-07-11, released 2001-01-10
The last revision prior to the SCOP 1.63 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gg3A (A:)
    mhckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsak
    eikkqvrgvpwnftfnvkfyppdpaqlteditryylclqlrqdivagrlpcsfatlallg
    sytiqselgdydpelhgvdyvsdfklapnqtkeleekvmelhksyrsmtpaqadleflen
    akklsmygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffi
    kirpgeqeqyestigfklpsyraakklwkvcvehhtffr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gg3B (B:)
    mhckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsak
    eikkqvrgvpwnftfnvkfyppdpaqlteditryylclqlrqdivagrlpcsfatlallg
    sytiqselgdydpelhgvdyvsdfklapnqtkeleekvmelhksyrsmtpaqadleflen
    akklsmygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffi
    kirpgeqeqyestigfklpsyraakklwkvcvehhtffr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gg3C (C:)
    mhckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsak
    eikkqvrgvpwnftfnvkfyppdpaqlteditryylclqlrqdivagrlpcsfatlallg
    sytiqselgdydpelhgvdyvsdfklapnqtkeleekvmelhksyrsmtpaqadleflen
    akklsmygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffi
    kirpgeqeqyestigfklpsyraakklwkvcvehhtffr