PDB entry 1gg1

View 1gg1 on RCSB PDB site
Description: crystal structure analysis of dahp synthase in complex with mn2+ and 2-phosphoglycolate
Class: lyase
Keywords: beta-alpha-barrel, LYASE
Deposited on 2000-08-04, released 2000-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gg1a_
  • Chain 'B':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gg1b_
  • Chain 'C':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gg1c_
  • Chain 'D':
    Compound: 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gg1d_
  • Heterogens: PGA, MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gg1A (A:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gg1A (A:)
    dlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdp
    vaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglria
    rkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfk
    ngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhv
    aevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlv
    egnqslplaygksitdacigwedtdallrqlanavkarr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gg1B (B:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gg1B (B:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gg1C (C:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gg1C (C:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqsleplaygksitdacigwedtdallrqlanavkarr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gg1D (D:)
    mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gg1D (D:)
    lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqsleplaygksitdacigwedtdallrqlanavkarrg