PDB entry 1gfs

View 1gfs on RCSB PDB site
Description: GDP-fucose synthetase from e. coli
Class: oxidoreductase
Keywords: epimerase-reductase, nadp, GDP-fucose, lipopolysaccharide biosynthesis
Deposited on 1998-08-17, released 1999-08-17
The last revision prior to the SCOP 1.73 freeze date was dated 2000-05-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-fucose synthetase
    Species: ESCHERICHIA COLI
    Gene: WCAG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gfsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gfsA (A:)
    mskqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvy
    laaakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpma
    esellqgtleptnepyaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshv
    ipallrrfheataqnapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpml
    shinvgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheis
    leaglastyqwflenqdrfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gfsA (A:)
    kqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyla
    aakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpmaes
    ellqgtleptnepyaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvip
    allrrfheataqnapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmlsh
    invgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisle
    aglastyqwflenqdrf