PDB entry 1gfp

View 1gfp on RCSB PDB site
Description: ompf porin (mutant r42c)
Class: transmembrane protein
Keywords: outer membrane, transmembrane protein, porin, membrane protein
Deposited on 1996-05-08, released 1996-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix porin outer membrane protein f
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02931 (0-339)
      • engineered (41)
    Domains in SCOPe 2.08: d1gfpa_
  • Heterogens: C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gfpA (A:)
    aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyaclgfkgetqinsdltgygq
    weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
    dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
    eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
    tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
    yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf