PDB entry 1gfd

View 1gfd on RCSB PDB site
Description: solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
Class: adaptor protein containing sh2 and sh3
Keywords: adaptor protein containing sh2 and sh3
Deposited on 1994-06-13, released 1994-08-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-08-31, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: HOMO SAPIENS
    Gene: GRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gfda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gfdA (A:)
    gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr