PDB entry 1gfd

View 1gfd on RCSB PDB site
Description: solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
Class: adaptor protein containing sh2 and sh3
Keywords: adaptor protein containing sh2 and sh3
Deposited on 1994-06-13, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gfda1, d1gfda2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gfdA (A:)
    gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr