PDB entry 1gf6

View 1gf6 on RCSB PDB site
Description: buried polar mutant human lysozyme
Class: hydrolase
Keywords: buried polar, stability
Deposited on 2000-11-30, released 2001-04-18
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (98)
    Domains in SCOP 1.75: d1gf6a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gf6A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrtvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv