PDB entry 1gf3

View 1gf3 on RCSB PDB site
Description: buried polar mutant human lysozyme
Deposited on 2000-11-30, released 2001-04-18
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-18, with a file datestamp of 2001-04-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1gf3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gf3A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadsvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv