PDB entry 1gey

View 1gey on RCSB PDB site
Description: crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
Class: transferase
Keywords: alpha/beta-structure, N-(5'-PHOSPHOPYRIDOXYL)-L-GLUTAMATE, PPE, complex, TRANSFERASE
Deposited on 2000-11-30, released 2001-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.178
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1geya_
  • Heterogens: PPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1geyA (A:)
    mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqp
    kavienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaeti
    gvecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkai
    vvadeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkvi
    apyplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyi
    larfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1geyA (A:)
    titdlarenvrnlarvwlnaneyptavefqltqqtlnrypecqpkavienyaqyagvkpe
    qvlvsrgadegiellirafcepgkdailycpptygmysvsaetigvecrtvptldnwqld
    lqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvadeayiefcpqasl
    agwlaeyphlailrtlskafalaglrcgftlaneevinllmkviapyplstpvadiaaqa
    lspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyilarfkassavfkslwd
    qgiilrdqnkqpslsgclritvgtreesqrvidal