PDB entry 1gey

View 1gey on RCSB PDB site
Description: crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
Deposited on 2000-11-30, released 2001-04-12
The last revision prior to the SCOP 1.71 freeze date was dated 2001-04-12, with a file datestamp of 2001-04-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.178
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1geya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1geyA (A:)
    mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqp
    kavienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaeti
    gvecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkai
    vvadeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkvi
    apyplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyi
    larfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1geyA (A:)
    titdlarenvrnlarvwlnaneyptavefqltqqtlnrypecqpkavienyaqyagvkpe
    qvlvsrgadegiellirafcepgkdailycpptygmysvsaetigvecrtvptldnwqld
    lqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvadeayiefcpqasl
    agwlaeyphlailrtlskafalaglrcgftlaneevinllmkviapyplstpvadiaaqa
    lspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyilarfkassavfkslwd
    qgiilrdqnkqpslsgclritvgtreesqrvidal