PDB entry 1gex

View 1gex on RCSB PDB site
Description: crystal structure of histidinol-phosphate aminotransferase complexed with histidinol-phosphate
Deposited on 2000-11-30, released 2001-04-18
The last revision prior to the SCOP 1.71 freeze date was dated 2001-04-18, with a file datestamp of 2001-04-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gexa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gexA (A:)
    mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqp
    kavienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaeti
    gvecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkai
    vvadeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkvi
    apyplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyi
    larfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gexA (A:)
    titdlarenvrnltpyqgdvwlnaneyptavefqltqqtlnrypecqpkavienyaqyag
    vkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigvecrtvptldn
    wqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvadeayiefcp
    qaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviapyplstpvadi
    aaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyilarfkassavfk
    slwdqgiilrdqnkqpslsgclritvgtreesqrvidal