PDB entry 1gew

View 1gew on RCSB PDB site
Description: crystal structure of histidinol-phosphate aminotransferase complexed with pyridoxal 5'-phosphate
Deposited on 2000-11-30, released 2001-04-18
The last revision prior to the SCOP 1.71 freeze date was dated 2001-04-18, with a file datestamp of 2001-04-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gewa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gewA (A:)
    mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqp
    kavienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaeti
    gvecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkai
    vvadeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkvi
    apyplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyi
    larfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gewA (A:)
    titdlarenvrnlvwlnaneyptavefqltqqtlnrypecqpkavienyaqyagvkpeqv
    lvsrgadegiellirafcepgkdailycpptygmysvsaetigvecrtvptldnwqldlq
    gisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvadeayiefcpqaslag
    wlaeyphlailrtlskafalaglrcgftlaneevinllmkviapyplstpvadiaaqals
    pqgivamrervaqiiaereyliaalkeipcveqvfdsetnyilarfkassavfkslwdqg
    iilrdqnkqpslsgclritvgtreesqrvidal