PDB entry 1gew

View 1gew on RCSB PDB site
Description: crystal structure of histidinol-phosphate aminotransferase complexed with pyridoxal 5'-phosphate
Class: transferase
Keywords: alpha/beta-structure, Aminotransferase, PYRIDOXAL-5'-PHOSPHATE, complex, TRANSFERASE
Deposited on 2000-11-30, released 2001-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gewa_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gewA (A:)
    mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqp
    kavienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaeti
    gvecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkai
    vvadeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkvi
    apyplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyi
    larfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gewA (A:)
    titdlarenvrnlvwlnaneyptavefqltqqtlnrypecqpkavienyaqyagvkpeqv
    lvsrgadegiellirafcepgkdailycpptygmysvsaetigvecrtvptldnwqldlq
    gisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvadeayiefcpqaslag
    wlaeyphlailrtlskafalaglrcgftlaneevinllmkviapyplstpvadiaaqals
    pqgivamrervaqiiaereyliaalkeipcveqvfdsetnyilarfkassavfkslwdqg
    iilrdqnkqpslsgclritvgtreesqrvidal