PDB entry 1geu

View 1geu on RCSB PDB site
Description: anatomy of an engineered nad-binding site
Class: oxidoreductase(flavoenzyme)
Keywords: oxidoreductase(flavoenzyme)
Deposited on 1994-01-18, released 1994-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06715 (Start-449)
      • engineered (178)
      • engineered (182)
      • engineered (196-199)
      • engineered (203)
    Domains in SCOPe 2.07: d1geua1, d1geua2, d1geua3
  • Chain 'B':
    Compound: glutathione reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06715 (Start-449)
      • engineered (178)
      • engineered (182)
      • engineered (196-199)
      • engineered (203)
    Domains in SCOPe 2.07: d1geub1, d1geub2, d1geub3
  • Heterogens: FAD, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1geuA (A:)
    mtkhydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqir
    eaihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvda
    ktlevngetitadhiliatggrpshpdipgveygidsdgffalpalpervavvgagyigv
    elggvinglgakthlfemfdaplpsfdpmisetlvevmnaegpqlhtnaipkavvkntdg
    sltleledgrsetvdcliwaigrepandninleaagvktnekgyivvdkyqntniegiya
    vgdntgaveltpvavaagrrlserlfnnkpdehldysniptvvfshppigtvgltepqar
    eqygddqvkvykssftamytavtthrqpcrmklvcvgseekivgihgigfgmdemlqgfa
    valkmgatkkdfdntvaihptaaeefvtmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1geuA (A:)
    khydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqirea
    ihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvdakt
    levngetitadhiliatggrpshpdipgveygidsdgffalpalpervavvgagyigvel
    ggvinglgakthlfemfdaplpsfdpmisetlvevmnaegpqlhtnaipkavvkntdgsl
    tleledgrsetvdcliwaigrepandninleaagvktnekgyivvdkyqntniegiyavg
    dntgaveltpvavaagrrlserlfnnkpdehldysniptvvfshppigtvgltepqareq
    ygddqvkvykssftamytavtthrqpcrmklvcvgseekivgihgigfgmdemlqgfava
    lkmgatkkdfdntvaihptaaeefvtmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1geuB (B:)
    mtkhydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqir
    eaihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvda
    ktlevngetitadhiliatggrpshpdipgveygidsdgffalpalpervavvgagyigv
    elggvinglgakthlfemfdaplpsfdpmisetlvevmnaegpqlhtnaipkavvkntdg
    sltleledgrsetvdcliwaigrepandninleaagvktnekgyivvdkyqntniegiya
    vgdntgaveltpvavaagrrlserlfnnkpdehldysniptvvfshppigtvgltepqar
    eqygddqvkvykssftamytavtthrqpcrmklvcvgseekivgihgigfgmdemlqgfa
    valkmgatkkdfdntvaihptaaeefvtmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1geuB (B:)
    tkhydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqire
    aihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvdak
    tlevngetitadhiliatggrpshpdipgveygidsdgffalpalpervavvgagyigve
    lggvinglgakthlfemfdaplpsfdpmisetlvevmnaegpqlhtnaipkavvkntdgs
    ltleledgrsetvdcliwaigrepandninleaagvktnekgyivvdkyqntniegiyav
    gdntgaveltpvavaagrrlserlfnnkpdehldysniptvvfshppigtvgltepqare
    qygddqvkvykssftamytavtthrqpcrmklvcvgseekivgihgigfgmdemlqgfav
    alkmgatkkdfdntvaihptaaeefvtmr