PDB entry 1geu

View 1geu on RCSB PDB site
Description: anatomy of an engineered nad-binding site
Deposited on 1994-01-18, released 1994-11-01
The last revision prior to the SCOP 1.59 freeze date was dated 1994-11-01, with a file datestamp of 1994-11-11.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1geuA (A:)
    khydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqirea
    ihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvdakt
    levngetitadhiliatggrpshpdipgveygidsdgffalpalpervavvgagyigvel
    ggvinglgakthlfemfdaplpsfdpmisetlvevmnaegpqlhtnaipkavvkntdgsl
    tleledgrsetvdcliwaigrepandninleaagvktnekgyivvdkyqntniegiyavg
    dntgaveltpvavaagrrlserlfnnkpdehldysniptvvfshppigtvgltepqareq
    ygddqvkvykssftamytavtthrqpcrmklvcvgseekivgihgigfgmdemlqgfava
    lkmgatkkdfdntvaihptaaeefvtmr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1geuB (B:)
    tkhydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqire
    aihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvdak
    tlevngetitadhiliatggrpshpdipgveygidsdgffalpalpervavvgagyigve
    lggvinglgakthlfemfdaplpsfdpmisetlvevmnaegpqlhtnaipkavvkntdgs
    ltleledgrsetvdcliwaigrepandninleaagvktnekgyivvdkyqntniegiyav
    gdntgaveltpvavaagrrlserlfnnkpdehldysniptvvfshppigtvgltepqare
    qygddqvkvykssftamytavtthrqpcrmklvcvgseekivgihgigfgmdemlqgfav
    alkmgatkkdfdntvaihptaaeefvtmr