PDB entry 1get

View 1get on RCSB PDB site
Description: anatomy of an engineered nad-binding site
Class: oxidoreductase(flavoenzyme)
Keywords: oxidoreductase(flavoenzyme)
Deposited on 1994-01-18, released 1994-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1geta1, d1geta2, d1geta3
  • Chain 'B':
    Compound: glutathione reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1getb1, d1getb2, d1getb3
  • Heterogens: FAD, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1getA (A:)
    mtkhydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqir
    eaihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvda
    ktlevngetitadhiliatggrpshpdipgveygidsdgffalpalpervavvgagyiav
    elagvinglgakthlfvrkhaplrsfdpmisetlvevmnaegpqlhtnaipkavvkntdg
    sltleledgrsetvdcliwaigrepandninleaagvktnekgyivvdkyqntniegiya
    vgdntgaveltpvavaagrrlserlfnnkpdehldysniptvvfshppigtvgltepqar
    eqygddqvkvykssftamytavtthrqpcrmklvcvgseekivgihgigfgmdemlqgfa
    valkmgatkkdfdntvaihptaaeefvtmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1getA (A:)
    khydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqirea
    ihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvdakt
    levngetitadhiliatggrpshpdipgveygidsdgffalpalpervavvgagyiavel
    agvinglgakthlfvrkhaplrsfdpmisetlvevmnaegpqlhtnaipkavvkntdgsl
    tleledgrsetvdcliwaigrepandninleaagvktnekgyivvdkyqntniegiyavg
    dntgaveltpvavaagrrlserlfnnkpdehldysniptvvfshppigtvgltepqareq
    ygddqvkvykssftamytavtthrqpcrmklvcvgseekivgihgigfgmdemlqgfava
    lkmgatkkdfdntvaihptaaeefvtmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1getB (B:)
    mtkhydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqir
    eaihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvda
    ktlevngetitadhiliatggrpshpdipgveygidsdgffalpalpervavvgagyiav
    elagvinglgakthlfvrkhaplrsfdpmisetlvevmnaegpqlhtnaipkavvkntdg
    sltleledgrsetvdcliwaigrepandninleaagvktnekgyivvdkyqntniegiya
    vgdntgaveltpvavaagrrlserlfnnkpdehldysniptvvfshppigtvgltepqar
    eqygddqvkvykssftamytavtthrqpcrmklvcvgseekivgihgigfgmdemlqgfa
    valkmgatkkdfdntvaihptaaeefvtmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1getB (B:)
    tkhydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqire
    aihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvdak
    tlevngetitadhiliatggrpshpdipgveygidsdgffalpalpervavvgagyiave
    lagvinglgakthlfvrkhaplrsfdpmisetlvevmnaegpqlhtnaipkavvkntdgs
    ltleledgrsetvdcliwaigrepandninleaagvktnekgyivvdkyqntniegiyav
    gdntgaveltpvavaagrrlserlfnnkpdehldysniptvvfshppigtvgltepqare
    qygddqvkvykssftamytavtthrqpcrmklvcvgseekivgihgigfgmdemlqgfav
    alkmgatkkdfdntvaihptaaeefvtmr