PDB entry 1gee

View 1gee on RCSB PDB site
Description: Crystal structure of glucose dehydrogenase mutant Q252L complexed with NAD+
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductase, oxidoreductase
Deposited on 2000-11-07, released 2003-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.195
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose 1-dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40288 (0-260)
      • engineered (251)
    Domains in SCOPe 2.07: d1geea_
  • Chain 'B':
    Compound: glucose 1-dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40288 (0-260)
      • engineered (251)
    Domains in SCOPe 2.07: d1geeb_
  • Chain 'E':
    Compound: glucose 1-dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40288 (0-260)
      • engineered (251)
    Domains in SCOPe 2.07: d1geee_
  • Chain 'F':
    Compound: glucose 1-dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40288 (0-260)
      • engineered (251)
    Domains in SCOPe 2.07: d1geef_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1geeA (A:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtetlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtlypsfqagrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1geeB (B:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtetlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtlypsfqagrg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1geeE (E:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtetlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtlypsfqagrg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1geeF (F:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtetlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtlypsfqagrg