PDB entry 1ged

View 1ged on RCSB PDB site
Description: A positive charge route for the access of nadh to heme formed in the distal heme pocket of cytochrome p450nor
Deposited on 2000-11-02, released 2000-11-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1geda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gedA (A:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif