PDB entry 1gec

View 1gec on RCSB PDB site
Description: glycyl endopeptidase-complex with benzyloxycarbonyl-leucine-valine-glycine-methylene covalently bound to cysteine 25
Class: hydrolase/hydrolase inhibitor
Keywords: proteinase, hydrolase-hydrolase inhibitor complex
Deposited on 1995-05-25, released 1995-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: glycyl endopeptidase
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05994 (0-215)
      • conflict (57)
    Domains in SCOPe 2.08: d1gece_
  • Chain 'I':
    Compound: benzyloxycarbonyl-leucine-valine-glycine-methylene inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1GEC (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gecE (E:)
lpesvdwrakgavtpvkhqgycescwafstvatveginkiktgnlvelseqelvdcdlqs
ygcnrgyqstslqyvaqngihlrakypyiakqqtcranqvggpkvktngvgrvqsnnegs
llnaiahqpvsvvvesagrdfqnykggifegscgtkvdhavtavgygksggkgyilikns
wgpgwgengyirirrasgnspgvcgvyrssyypikn

  • Chain 'I':
    No sequence available.