PDB entry 1ge2

View 1ge2 on RCSB PDB site
Description: crystal structure of mutant human lysozyme substituted at left-handed helical positions
Deposited on 2000-10-06, released 2000-11-08
The last revision prior to the SCOP 1.57 freeze date was dated 2000-11-08, with a file datestamp of 2000-11-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.16
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1ge2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ge2A (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnacalscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv