PDB entry 1gdv

View 1gdv on RCSB PDB site
Description: crystal structure of cytochrome c6 from red alga porphyra yezoensis at 1.57 a resolution
Deposited on 2000-10-06, released 2001-04-06
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-06, with a file datestamp of 2001-04-06.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.199
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1gdva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gdvA (A:)
  adldngekvfsancaachaggnnaimpdktlkkdvleansmntidaityqvqngknampa
  fggrlvdediedaanyvlsqsekgw