PDB entry 1gdq

View 1gdq on RCSB PDB site
Description: fusarium oxysporum trypsin at atomic resolution
Class: hydrolase
Keywords: beta-barrel, HYDROLASE
Deposited on 2000-09-28, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 0.93 Å
R-factor: 0.099
AEROSPACI score: 1.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gdqa_
  • Chain 'B':
    Compound: gly-ala-arg
    Database cross-references and differences (RAF-indexed):
    • PDB 1GDQ (Start-2)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gdqA (A:)
    ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
    tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
    agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
    ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya
    

  • Chain 'B':
    No sequence available.