PDB entry 1gdj

View 1gdj on RCSB PDB site
Description: crystal structure of ferric complexes of the yellow lupin leghemoglobin with isoquinoline at 1.8 angstroms resolution (russian)
Deposited on 1994-09-14, released 1995-02-27
The last revision prior to the SCOP 1.69 freeze date was dated 2003-04-22, with a file datestamp of 2003-04-22.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1gdj__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gdj_ (-)
  galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
  qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
  vvgakwseelnsawtiaydelaivikkemddaa