PDB entry 1gdh

View 1gdh on RCSB PDB site
Description: crystal structure of a nad-dependent d-glycerate dehydrogenase at 2.4 angstroms resolution
Class: oxidoreductase(choh (d)-nad(p)+ (a))
Keywords: oxidoreductase(choh (d)-nad(p)+ (a))
Deposited on 1993-09-22, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-glycerate dehydrogenase
    Species: Hyphomicrobium methylovorum [TaxId:84]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gdha1, d1gdha2
  • Chain 'B':
    Compound: d-glycerate dehydrogenase
    Species: Hyphomicrobium methylovorum [TaxId:84]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gdhb1, d1gdhb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gdhA (A:)
    kkkilitwplpeaamararesydviahgddpkitidemietaksvdallitlnekcrkev
    idripenikcistysigfdhidldackargikvgnaphgvtvataeiamllllgsarrag
    egekmirtrswpgweplelvgekldnktlgiygfgsigqalakraqgfdmdidyfdthra
    sssdeasyqatfhdsldsllsvsqffslnapstpetryffnkatikslpqgaivvntarg
    dlvdnelvvaaleagrlayagfdvfagepninegyydlpntflfphigsaatqaredmah
    qandlidalfggadmsyala
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gdhB (B:)
    kkkilitwplpeaamararesydviahgddpkitidemietaksvdallitlnekcrkev
    idripenikcistysigfdhidldackargikvgnaphgvtvataeiamllllgsarrag
    egekmirtrswpgweplelvgekldnktlgiygfgsigqalakraqgfdmdidyfdthra
    sssdeasyqatfhdsldsllsvsqffslnapstpetryffnkatikslpqgaivvntarg
    dlvdnelvvaaleagrlayagfdvfagepninegyydlpntflfphigsaatqaredmah
    qandlidalfggadmsyala