PDB entry 1gdf

View 1gdf on RCSB PDB site
Description: structure of rhogdi: a c-terminal binding domain targets an n-terminal inhibitory peptide to gtpases, nmr, minimized average structure
Deposited on 1997-05-11, released 1997-11-19
The last revision prior to the SCOP 1.71 freeze date was dated 1997-11-19, with a file datestamp of 1997-11-19.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1gdf__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gdf_ (-)
  avsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvn
  reivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniks
  rftdddrtdhlswewnltikkewkd