PDB entry 1gde

View 1gde on RCSB PDB site
Description: crystal structure of pyrococcus protein a-1 e-form
Deposited on 2000-09-23, released 2001-09-23
The last revision prior to the SCOP 1.71 freeze date was dated 2001-09-23, with a file datestamp of 2001-09-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gdea_
  • Chain 'B':
    Domains in SCOP 1.71: d1gdeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gdeA (A:)
    malsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthyg
    pnigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpa
    fvsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkk
    dleeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgw
    rlgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrkl
    vwkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegy
    vrisyatayekleeamdrmervlkerklv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gdeA (A:)
    alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
    nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
    vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
    leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
    lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
    wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
    risyatayekleeamdrmervlkerklv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gdeB (B:)
    malsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthyg
    pnigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpa
    fvsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkk
    dleeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgw
    rlgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrkl
    vwkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegy
    vrisyatayekleeamdrmervlkerklv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gdeB (B:)
    alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
    nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
    vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
    leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
    lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
    wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
    risyatayekleeamdrmervlkerklv