PDB entry 1gdc

View 1gdc on RCSB PDB site
Description: refined solution structure of the glucocorticoid receptor DNA-binding domain
Class: glucocorticoid receptor
Keywords: glucocorticoid receptor
Deposited on 1994-03-15, released 1994-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gdca_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gdcA (A:)
    lclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
    kclqagmnlear