PDB entry 1gd9

View 1gd9 on RCSB PDB site
Description: crystall structure of pyrococcus protein-a1
Class: transferase
Keywords: aminotransferase, pyridoxal enzyme, temperature dependence of substrate recognition
Deposited on 2000-09-22, released 2001-09-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gd9a_
  • Chain 'B':
    Compound: aspartate aminotransferase
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gd9b_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gd9A (A:)
    malsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthyg
    pnigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpa
    fvsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkk
    dleeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgw
    rlgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrkl
    vwkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegy
    vrisyatayekleeamdrmervlkerklv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd9A (A:)
    alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
    nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
    vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
    leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
    lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
    wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
    risyatayekleeamdrmervlkerklv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gd9B (B:)
    malsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthyg
    pnigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpa
    fvsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkk
    dleeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgw
    rlgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrkl
    vwkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegy
    vrisyatayekleeamdrmervlkerklv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd9B (B:)
    alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
    nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
    vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
    leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
    lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
    wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
    risyatayekleeamdrmervlkerklv