PDB entry 1gd9

View 1gd9 on RCSB PDB site
Description: crystall structure of pyrococcus protein-a1
Deposited on 2000-09-22, released 2001-09-22
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-22, with a file datestamp of 2001-09-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1gd9a_
  • Chain 'B':
    Domains in SCOP 1.57: d1gd9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd9A (A:)
    alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
    nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
    vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
    leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
    lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
    wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
    risyatayekleeamdrmervlkerklv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd9B (B:)
    alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
    nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
    vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
    leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
    lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
    wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
    risyatayekleeamdrmervlkerklv