PDB entry 1gd8

View 1gd8 on RCSB PDB site
Description: the crystal structure of bacteria-specific l17 ribosomal protein.
Class: ribosome
Keywords: TWO DOMAINS, RIBOSOMAL PROTEIN S8-LIKE DOMAIN, TRP REPRESSOR-LIKE DOMAIN, HELIX-TURN-HELIX MOTIF, TWO TYPES OF DIMERS, FOUR DIMERS OF EACH TYPE., RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RIBOSOME
Deposited on 2000-09-22, released 2001-09-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gd8a_
  • Chain 'B':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gd8b_
  • Chain 'C':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gd8c_
  • Chain 'D':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gd8d_
  • Chain 'E':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gd8e_
  • Chain 'F':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gd8f_
  • Chain 'G':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gd8g_
  • Chain 'H':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gd8h_
  • Chain 'I':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gd8i_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gd8A (A:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd8A (A:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gd8B (B:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd8B (B:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gd8C (C:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd8C (C:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gd8D (D:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd8D (D:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gd8E (E:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd8E (E:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gd8F (F:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd8F (F:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gd8G (G:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd8G (G:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1gd8H (H:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd8H (H:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1gd8I (I:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gd8I (I:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve