PDB entry 1gd6

View 1gd6 on RCSB PDB site
Description: structure of the bombyx mori lysozyme
Deposited on 2000-09-19, released 2001-03-21
The last revision prior to the SCOP 1.69 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1gd6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd6A (A:)
    ktftrcglvhelrkhgfeenlmrnwvclvehessrdtsktntnrngskdyglfqindryw
    cskgaspgkdcnvkcsdlltdditkaakcakkiykrhrfdawygwknhcqgslpdissc