PDB entry 1gd5

View 1gd5 on RCSB PDB site
Description: solution structure of the px domain from human p47phox nadph oxidase
Class: protein binding
Keywords: alpha beta,p47-phox,px domain, protein binding
Deposited on 2000-09-14, released 2001-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14598 (2-129)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1gd5a1, d1gd5a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd5A (A:)
    gsmgdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemf
    pieagainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldff
    kvrpddlklp