PDB entry 1gd5

View 1gd5 on RCSB PDB site
Description: solution structure of the px domain from human p47phox nadph oxidase
Class: protein binding
Keywords: alpha beta,p47-phox,px domain, protein binding
Deposited on 2000-09-14, released 2001-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neutrophil cytosol factor 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14598 (2-129)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d1gd5a1, d1gd5a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gd5A (A:)
  gsmgdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemf
  pieagainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldff
  kvrpddlklp