PDB entry 1gd4

View 1gd4 on RCSB PDB site
Description: solution structure of p25s cystatin a
Class: protein binding
Keywords: cystatin A, Thiol protease inhibitor, PROTEIN BINDING
Deposited on 2000-09-08, released 2001-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cystatin a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01040 (0-97)
      • engineered (24)
      • engineered (64)
    Domains in SCOPe 2.08: d1gd4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd4A (A:)
    mipgglseakpatpeiqeivdkvksqleektnetygkleavqyktqvvagtnyyikvrag
    dnkylhlkvfkslpgqnedlvltgyqvdknkddeltgf