PDB entry 1gd1

View 1gd1 on RCSB PDB site
Description: structure of holo-glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophilus at 1.8 angstroms resolution
Class: oxidoreductase(aldehyde(d)-nad(a))
Keywords: oxidoreductase(aldehyde(d)-nad(a))
Deposited on 1987-06-22, released 1988-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: BACILLUS STEAROTHERMOPHILUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gd1o1, d1gd1o2
  • Chain 'P':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: BACILLUS STEAROTHERMOPHILUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gd1p1, d1gd1p2
  • Chain 'Q':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: BACILLUS STEAROTHERMOPHILUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gd1q1, d1gd1q2
  • Chain 'R':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: BACILLUS STEAROTHERMOPHILUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gd1r1, d1gd1r2
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd1O (O:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd1P (P:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd1Q (Q:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd1R (R:)
    avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildlphkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl